Lineage for d4i6wa2 (4i6w A:111-220)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1654161Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 1654162Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 1654163Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 1654201Species Pseudomonas mevalonii [TaxId:32044] [55039] (11 PDB entries)
    Uniprot P13702 4-377
  8. 1654206Domain d4i6wa2: 4i6w A:111-220 [222963]
    Other proteins in same PDB: d4i6wa1, d4i6wb1
    automated match to d1r31a1
    complexed with 1co, gol, so4

Details for d4i6wa2

PDB Entry: 4i6w (more details), 1.66 Å

PDB Description: 3-hydroxy-3-methylglutaryl (hmg) coenzyme-a reductase complexed with thiomevalonate
PDB Compounds: (A:) 3-hydroxy-3-methylglutaryl-coenzyme A reductase

SCOPe Domain Sequences for d4i6wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i6wa2 d.58.20.1 (A:111-220) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl

SCOPe Domain Coordinates for d4i6wa2:

Click to download the PDB-style file with coordinates for d4i6wa2.
(The format of our PDB-style files is described here.)

Timeline for d4i6wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i6wa1