Lineage for d4i6ja1 (4i6j A:21-225)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1842687Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 1842688Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 1842723Family c.28.1.0: automated matches [227292] (1 protein)
    not a true family
  6. 1842724Protein automated matches [227113] (2 species)
    not a true protein
  7. 1842732Species Mouse (Mus musculus) [TaxId:10090] [226619] (5 PDB entries)
  8. 1842739Domain d4i6ja1: 4i6j A:21-225 [222958]
    Other proteins in same PDB: d4i6jc1, d4i6jc2
    automated match to d1qnfa2

Details for d4i6ja1

PDB Entry: 4i6j (more details), 2.7 Å

PDB Description: A ubiquitin ligase-substrate complex
PDB Compounds: (A:) Cryptochrome-2

SCOPe Domain Sequences for d4i6ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i6ja1 c.28.1.0 (A:21-225) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
assvhwfrkglrlhdnpallaavrgarcvrcvyildpwfaasssvginrwrfllqsledl
dtslrklnsrlfvvrgqpadvfprlfkewgvtrltfeydsepfgkerdaaimkmakeagv
evvtenshtlydldriielngqkppltykrfqalisrmelpkkpavavssqqmescraei
qenhddtygvpsleelgfpteglgp

SCOPe Domain Coordinates for d4i6ja1:

Click to download the PDB-style file with coordinates for d4i6ja1.
(The format of our PDB-style files is described here.)

Timeline for d4i6ja1: