Lineage for d4i50e_ (4i50 E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733915Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2733916Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2733917Protein Stathmin 4 [101496] (3 species)
  7. 2733934Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)
  8. 2734053Domain d4i50e_: 4i50 E: [222922]
    Other proteins in same PDB: d4i50a1, d4i50a2, d4i50b1, d4i50b2, d4i50c1, d4i50c2, d4i50d1, d4i50d2, d4i50f1, d4i50f2, d4i50f3
    automated match to d4ihje_
    complexed with acp, ca, cl, ep, gdp, gol, gtp, mes, mg

Details for d4i50e_

PDB Entry: 4i50 (more details), 2.3 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-epothilone a complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d4i50e_:

Sequence, based on SEQRES records: (download)

>d4i50e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records): (download)

>d4i50e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

SCOPe Domain Coordinates for d4i50e_:

Click to download the PDB-style file with coordinates for d4i50e_.
(The format of our PDB-style files is described here.)

Timeline for d4i50e_: