Lineage for d4hypc_ (4hyp C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213403Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 2213461Protein automated matches [191126] (2 species)
    not a true protein
  7. 2213462Species Escherichia coli K-12 [TaxId:83333] [226425] (3 PDB entries)
  8. 2213469Domain d4hypc_: 4hyp C: [222800]
    automated match to d1kzna_
    complexed with 1a1, mg

Details for d4hypc_

PDB Entry: 4hyp (more details), 2.6 Å

PDB Description: Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
PDB Compounds: (C:) DNA gyrase subunit b

SCOPe Domain Sequences for d4hypc_:

Sequence, based on SEQRES records: (download)

>d4hypc_ d.122.1.2 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqdd
grgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvnalsqklelvi
qregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrlrel
sflnsgvsirlrdkrdgkedhfhy

Sequence, based on observed residues (ATOM records): (download)

>d4hypc_ d.122.1.2 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsvqdd
grgiptgivsaaevimtvlhaggkfkvsgglhgvgvsvvnalsqklelviqregkihrqi
yehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrlrelsflnsgvsir
lrdkrdgkedhfhy

SCOPe Domain Coordinates for d4hypc_:

Click to download the PDB-style file with coordinates for d4hypc_.
(The format of our PDB-style files is described here.)

Timeline for d4hypc_: