SCOPe 2.08: Domain d4hyma1: 4hym A:7-215

Lineage for d4hyma1 (4hym A:7-215)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (22 species)
   not a true protein

7. Species Francisella tularensis [TaxId:376619] [226591] (4 PDB entries)

8. Domain d4hyma1: 4hym A:7-215 [222795]
   Other proteins in same PDB: d4hyma2
   automated match to d1s16a2
   complexed with cjc

Details for d4hyma1

PDB Entry: 4hym, 1.9 Å

PDB Description: Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.

PDB Compounds: (A:) Topoisomerase IV, subunit B

SCOPe Domain Sequences for d4hyma1:

Sequence, based on SEQRES records:

>d4hyma1 d.122.1.0 (A:7-215) automated matches {Francisella tularensis [TaxId: 376619]}
ksievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsiev
addgrgmpvdihpehkmsgielimtklhsggkfsnknythsgglhgvgvsvvnalstrle
aeikrdgnvyhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknl
leakailckaltikysneikkekltwhfe

Sequence, based on observed residues (ATOM records):

>d4hyma1 d.122.1.0 (A:7-215) automated matches {Francisella tularensis [TaxId: 376619]}
ksievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsiev
addgrgmpvdihpehkmsgielimtklhsggkfsngglhgvgvsvvnalstrleaeikrd
gnvyhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknlleakai
lckaltikysneikkekltwhfe

Timeline for d4hyma1:

• d4hyma1 first appeared in SCOPe 2.03
  
• d4hyma1 appears in SCOPe 2.07