Lineage for d4hyma2 (4hym A:216-377)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157367Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2157368Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2158083Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2158084Protein automated matches [190826] (17 species)
    not a true protein
  7. 2158139Species Francisella tularensis [TaxId:376619] [226592] (4 PDB entries)
  8. 2158140Domain d4hyma2: 4hym A:216-377 [222796]
    Other proteins in same PDB: d4hyma1, d4hymb1
    automated match to d1s16a1
    complexed with cjc

Details for d4hyma2

PDB Entry: 4hym (more details), 1.9 Å

PDB Description: Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
PDB Compounds: (A:) Topoisomerase IV, subunit B

SCOPe Domain Sequences for d4hyma2:

Sequence, based on SEQRES records: (download)

>d4hyma2 d.14.1.0 (A:216-377) automated matches {Francisella tularensis [TaxId: 376619]}
tglkgyldhkleaetlpaepfiidnfsngdsyldavfcwcedpsesiknsyvnliptpqd
gthvtglkngiydaikayieknslsvknikitandsfaqlnyvisvkitnpqfagqtkek
lsnkdvtnfvatavkdlltiwlnqnpdearqiveniskvaqk

Sequence, based on observed residues (ATOM records): (download)

>d4hyma2 d.14.1.0 (A:216-377) automated matches {Francisella tularensis [TaxId: 376619]}
tglkgyldhkleaetlpaepfiidnfsngdsyldavfcwcedpsesiknsyvnliptpqd
gthvtglkngiydaikayieknsnikitandsfaqlnyvisvkitnpqfagqtkeklsnk
dvtnfvatavkdlltiwlnqnpdearqiveniskvaqk

SCOPe Domain Coordinates for d4hyma2:

Click to download the PDB-style file with coordinates for d4hyma2.
(The format of our PDB-style files is described here.)

Timeline for d4hyma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hyma1
View in 3D
Domains from other chains:
(mouse over for more information)
d4hymb1