SCOPe 2.08: Domain d1xsob_: 1xso B:

Lineage for d1xsob_ (1xso B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [49334] (1 PDB entry)

8. Domain d1xsob_: 1xso B: [22274]
   complexed with cu, zn

Details for d1xsob_

PDB Entry: 1xso, 1.49 Å

PDB Description: three-dimensional structure of xenopus laevis cu,zn superoxide dismutase b determined by x-ray crystallography at 1.5 angstroms resolution

PDB Compounds: (B:) Copper,Zinc Superoxide Dismutase

SCOPe Domain Sequences for d1xsob_:

Sequence; same for both SEQRES and ATOM records:

>d1xsob_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {African clawed frog (Xenopus laevis) [TaxId: 8355]}
vkavcvlagsgdvkgvvhfeqqdegavsvegkiegltdglhgfhihvfgdntngcmsags
hfnpenknhgapgdtdrhvgdlgnvtaeggvaqfkitdslislkgpnsiigrtavvheka
ddlgkggndeslktgnaggrlacgvigysp

Timeline for d1xsob_:

• d1xsob_ first appeared (with stable ids) in SCOP 1.55
  
• d1xsob_ appears in SCOPe 2.07