PDB entry 1xso

View 1xso on RCSB PDB site
Description: three-dimensional structure of xenopus laevis cu,zn superoxide dismutase b determined by x-ray crystallography at 1.5 angstroms resolution
Class: oxidoreductase (superoxide acceptor)
Keywords: oxidoreductase (superoxide acceptor)
Deposited on 1995-03-14, released 1995-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper,Zinc Superoxide Dismutase
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15107 (0-149)
      • conflict (59)
    Domains in SCOPe 2.08: d1xsoa_
  • Chain 'B':
    Compound: Copper,Zinc Superoxide Dismutase
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15107 (0-149)
      • conflict (59)
    Domains in SCOPe 2.08: d1xsob_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xsoA (A:)
vkavcvlagsgdvkgvvhfeqqdegavsvegkiegltdglhgfhihvfgdntngcmsags
hfnpenknhgapgdtdrhvgdlgnvtaeggvaqfkitdslislkgpnsiigrtavvheka
ddlgkggndeslktgnaggrlacgvigysp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xsoB (B:)
vkavcvlagsgdvkgvvhfeqqdegavsvegkiegltdglhgfhihvfgdntngcmsags
hfnpenknhgapgdtdrhvgdlgnvtaeggvaqfkitdslislkgpnsiigrtavvheka
ddlgkggndeslktgnaggrlacgvigysp