Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
Species Escherichia coli [TaxId:562] [52443] (24 PDB entries) |
Domain d4hr7f1: 4hr7 F:1-114 [222729] Other proteins in same PDB: d4hr7a2, d4hr7a3, d4hr7b_, d4hr7c2, d4hr7c3, d4hr7d_, d4hr7e2, d4hr7e3, d4hr7f2, d4hr7f3, d4hr7g_, d4hr7i_ automated match to d1dv1a2 complexed with edo, so4 |
PDB Entry: 4hr7 (more details), 2.5 Å
SCOPe Domain Sequences for d4hr7f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hr7f1 c.30.1.1 (F:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg
Timeline for d4hr7f1: