Lineage for d4hr7a1 (4hr7 A:1-114)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1842743Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1842744Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1842745Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 1842752Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 1842755Species Escherichia coli [TaxId:562] [52443] (24 PDB entries)
  8. 1842793Domain d4hr7a1: 4hr7 A:1-114 [222720]
    Other proteins in same PDB: d4hr7a2, d4hr7a3, d4hr7b_, d4hr7c2, d4hr7c3, d4hr7d_, d4hr7e2, d4hr7e3, d4hr7f2, d4hr7f3, d4hr7g_, d4hr7i_
    automated match to d1dv1a2
    complexed with edo, so4

Details for d4hr7a1

PDB Entry: 4hr7 (more details), 2.5 Å

PDB Description: Crystal Structure of Biotin Carboxyl Carrier Protein-Biotin Carboxylase Complex from E.coli
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d4hr7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hr7a1 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

SCOPe Domain Coordinates for d4hr7a1:

Click to download the PDB-style file with coordinates for d4hr7a1.
(The format of our PDB-style files is described here.)

Timeline for d4hr7a1: