Lineage for d4hr7c2 (4hr7 C:115-330)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928431Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1928459Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 1928466Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 1928469Species Escherichia coli [TaxId:562] [56069] (24 PDB entries)
  8. 1928507Domain d4hr7c2: 4hr7 C:115-330 [222724]
    Other proteins in same PDB: d4hr7a1, d4hr7a3, d4hr7b_, d4hr7c1, d4hr7c3, d4hr7d_, d4hr7e1, d4hr7e3, d4hr7f1, d4hr7f3, d4hr7g_, d4hr7i_
    automated match to d1dv1a3
    complexed with edo, so4

Details for d4hr7c2

PDB Entry: 4hr7 (more details), 2.5 Å

PDB Description: Crystal Structure of Biotin Carboxyl Carrier Protein-Biotin Carboxylase Complex from E.coli
PDB Compounds: (C:) biotin carboxylase

SCOPe Domain Sequences for d4hr7c2:

Sequence, based on SEQRES records: (download)

>d4hr7c2 d.142.1.2 (C:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

Sequence, based on observed residues (ATOM records): (download)

>d4hr7c2 d.142.1.2 (C:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasrvvrgdaelaqsi
dmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvveeapapgitpelrry
igercakacvdigyrgagtfeflfengefyfiemntriqvehpvtemitgvdlikeqlri
aagqplsikqeevhv

SCOPe Domain Coordinates for d4hr7c2:

Click to download the PDB-style file with coordinates for d4hr7c2.
(The format of our PDB-style files is described here.)

Timeline for d4hr7c2: