SCOPe 2.08: Domain d4hmua_: 4hmu A:

Lineage for d4hmua_ (4hmu A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein Pyridoxine 5'-phoshate oxidase (PNP oxidase) [50479] (6 species)
   elaborated with additional secondary structures; active as dimer

7. Species Pseudomonas fluorescens [TaxId:294] [117227] (5 PDB entries)
   Uniprot Q51793

8. Domain d4hmua_: 4hmu A: [222681]
   automated match to d1ty9b_
   complexed with fmn, so4, wub
   has additional insertions and/or extensions that are not grouped together

Details for d4hmua_

PDB Entry: 4hmu, 1.56 Å

PDB Description: Crystal structure of PhzG from Pseudomonas fluorescens 2-79 in complex with tetrahydrophenazine-1-carboxylic acid after 1 day of soaking

PDB Compounds: (A:) Phenazine biosynthesis protein phzG

SCOPe Domain Sequences for d4hmua_:

Sequence; same for both SEQRES and ATOM records:

>d4hmua_ b.45.1.1 (A:) Pyridoxine 5'-phoshate oxidase (PNP oxidase) {Pseudomonas fluorescens [TaxId: 294]}
gtldapfpeyqtlpadpmsvlhnwlerarrvgirepralalatadsqgrpstrivvisei
sdagvvfsthagsqkgrellhnpwasgvlywretsqqiilngqavrlpnakaddawlkrp
yathpmssvsrqseelqdvqamrnaarqlaelqgplprpegycvfelrleslefwgngqe
rlherlrydrsdtgwnvrrlqp

Timeline for d4hmua_:

• d4hmua_ first appeared in SCOPe 2.03
  
• d4hmua_ appears in SCOPe 2.07