Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225406] (21 PDB entries) |
Domain d4hhzc2: 4hhz C:136-350 [222615] Other proteins in same PDB: d4hhza1, d4hhzb1, d4hhzc1, d4hhzd1 automated match to d1gs0a2 complexed with 15s, so4 |
PDB Entry: 4hhz (more details), 2.72 Å
SCOPe Domain Sequences for d4hhzc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hhzc2 d.166.1.0 (C:136-350) automated matches {Human (Homo sapiens) [TaxId: 9606]} lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis sgvndtsllyneyivydiaqvnlkyllklkfnfkt
Timeline for d4hhzc2: