SCOPe 2.06: Domain d4hgob_: 4hgo B:

Lineage for d4hgob_ (4hgo B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (51 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [224914] (4 PDB entries)

8. Domain d4hgob_: 4hgo B: [222579]
   automated match to d3nrjl_
   complexed with kdn, mg, vn4

Details for d4hgob_

PDB Entry: 4hgo, 2.1 Å

PDB Description: 2-keto-3-deoxy-d-glycero-d-galactonononate-9-phosphate phosphohydrolase from bacteroides thetaiotaomicron in complex with transition state mimic

PDB Compounds: (B:) Acylneuraminate cytidylyltransferase

SCOPe Domain Sequences for d4hgob_:

Sequence; same for both SEQRES and ATOM records:

>d4hgob_ c.108.1.0 (B:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
mkeikliltdidgvwtdggmfydqtgnewkkfntsdsagifwahnkgipvgiltgektei
vrrraeklkvdylfqgvvdklsaaeelcnelginleqvayigddlndakllkrvgiagvp
asapfyirrlstiflekrggegvfrefvekvlginledfiavi

Timeline for d4hgob_:

• d4hgob_ first appeared in SCOPe 2.03
  
• d4hgob_ appears in SCOPe 2.05
  
• d4hgob_ appears in SCOPe 2.07
  
• d4hgob_ appears in the current release, SCOPe 2.08