SCOPe 2.07: Domain d4hc1n1: 4hc1 N:1-107

Lineage for d4hc1n1 (4hc1 N:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d4hc1n1: 4hc1 N:1-107 [222496]
   Other proteins in same PDB: d4hc1a1, d4hc1a2, d4hc1a3, d4hc1b1, d4hc1b2, d4hc1b3, d4hc1l2, d4hc1n2
   automated match to d1c12a1
   complexed with nag; mutant

Details for d4hc1n1

PDB Entry: 4hc1, 2.87 Å

PDB Description: crystal structure of a loop deleted mutant of human madcam-1 d1d2 complexed with fab 10g3

PDB Compounds: (N:) 10G3 light chain

SCOPe Domain Sequences for d4hc1n1:

Sequence; same for both SEQRES and ATOM records:

>d4hc1n1 b.1.1.1 (N:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsftchasqgigrnigwlqqkpgksfkgliyhgtnlkdgvps
rfsgsgsgadysltisriesedfadyyciqyvqfpytfgggtkleik

Timeline for d4hc1n1:

• d4hc1n1 first appeared in SCOPe 2.03
  
• d4hc1n1 appears in SCOPe 2.06
  
• d4hc1n1 appears in the current release, SCOPe 2.08