| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.223: Polo-box domain [82614] (1 superfamily) beta(6)-alpha; antiparallel beta-sheet, meander |
Superfamily d.223.1: Polo-box domain [82615] (3 families) ![]() Serine/threonine protein kinase-associated motif embedded in two distinct folds |
| Family d.223.1.2: Polo-box duplicated region [102856] (1 protein) duplication: consists of two polo-box domains; binds phosphothreonine peptide |
| Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [102858] (28 PDB entries) |
| Domain d4h71b2: 4h71 B:507-593 [222420] automated match to d1q4kb2 complexed with gol, pxe |
PDB Entry: 4h71 (more details), 1.93 Å
SCOPe Domain Sequences for d4h71b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h71b2 d.223.1.2 (B:507-593) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rlpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfrtyrlsl
leeygcckelasrlryartmvdkllss
Timeline for d4h71b2: