SCOPe 2.08: Domain d4h71b1: 4h71 B:372-500

Lineage for d4h71b1 (4h71 B:372-500)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.223: Polo-box domain [82614] (1 superfamily)
   beta(6)-alpha; antiparallel beta-sheet, meander

4. Superfamily d.223.1: Polo-box domain [82615] (3 families)
   Serine/threonine protein kinase-associated motif embedded in two distinct folds

5. Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
   duplication: consists of two polo-box domains; binds phosphothreonine peptide

6. Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102858] (28 PDB entries)

8. Domain d4h71b1: 4h71 B:372-500 [222419]
   automated match to d3bzia1
   complexed with gol, pxe

Details for d4h71b1

PDB Entry: 4h71, 1.93 Å

PDB Description: Human Plk1-PBD in complex with Poloxime ((E)-4-(hydroxyimino)-2-isopropyl-5-methylcyclohexa-2,5-dienone)

PDB Compounds: (B:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d4h71b1:

Sequence; same for both SEQRES and ATOM records:

>d4h71b1 d.223.1.2 (B:372-500) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
chlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdns
vgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehll
kaganitpr

Timeline for d4h71b1:

• d4h71b1 first appeared in SCOPe 2.03
  
• d4h71b1 appears in SCOPe 2.07