Lineage for d4h2yc_ (4h2y C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487378Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1487379Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1487438Protein automated matches [190286] (8 species)
    not a true protein
  7. 1487439Species Agrobacterium tumefaciens [TaxId:176299] [226607] (3 PDB entries)
  8. 1487442Domain d4h2yc_: 4h2y C: [222346]
    automated match to d2jq4a1
    protein/RNA complex; complexed with atp, mg, pns, zn

Details for d4h2yc_

PDB Entry: 4h2y (more details), 2.1 Å

PDB Description: crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and atp
PDB Compounds: (C:) Aminoacyl carrier protein

SCOPe Domain Sequences for d4h2yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h2yc_ a.28.1.1 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
hmnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnlln
rksfasikaiedtvkli

SCOPe Domain Coordinates for d4h2yc_:

Click to download the PDB-style file with coordinates for d4h2yc_.
(The format of our PDB-style files is described here.)

Timeline for d4h2yc_: