Lineage for d4h2wd_ (4h2w D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993360Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1993361Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1993362Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1993425Protein automated matches [190286] (9 species)
    not a true protein
  7. 1993426Species Agrobacterium tumefaciens [TaxId:176299] [226607] (3 PDB entries)
  8. 1993428Domain d4h2wd_: 4h2w D: [222343]
    Other proteins in same PDB: d4h2wc2
    automated match to d2jq4a1
    protein/RNA complex; complexed with 5gp, amp, cl, pns, zn

Details for d4h2wd_

PDB Entry: 4h2w (more details), 1.95 Å

PDB Description: crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and amp
PDB Compounds: (D:) Aminoacyl carrier protein

SCOPe Domain Sequences for d4h2wd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h2wd_ a.28.1.1 (D:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnllnr
ksfasikaiedtvkl

SCOPe Domain Coordinates for d4h2wd_:

Click to download the PDB-style file with coordinates for d4h2wd_.
(The format of our PDB-style files is described here.)

Timeline for d4h2wd_: