| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (52 species) not a true protein |
| Species Cryptococcus neoformans [TaxId:5207] [226536] (1 PDB entry) |
| Domain d4h0pb1: 4h0p B:5-209 [222306] Other proteins in same PDB: d4h0pa3, d4h0pb3 automated match to d1g99a1 |
PDB Entry: 4h0p (more details), 1.89 Å
SCOPe Domain Sequences for d4h0pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0pb1 c.55.1.0 (B:5-209) automated matches {Cryptococcus neoformans [TaxId: 5207]}
aeyllaincgsssikgklfaipsfellanlavtnisssdervkikttweegkgkdseeea
dygdkiryaslvpilldhltnsthvkkeeikyvchrvvhggmhdkgirvvkgheeglmem
dklsefaplhnhravlavkscidalphhtslllfdtifhrtiapevytyalpppdteltm
plrkygfhglsyasivqslaehlkk
Timeline for d4h0pb1: