Lineage for d4h0pb1 (4h0p B:5-209)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606179Species Cryptococcus neoformans [TaxId:5207] [226536] (1 PDB entry)
  8. 1606182Domain d4h0pb1: 4h0p B:5-209 [222306]
    automated match to d1g99a1

Details for d4h0pb1

PDB Entry: 4h0p (more details), 1.89 Å

PDB Description: Crystal Structure of Acetate Kinase from Cryptococcus neoformans
PDB Compounds: (B:) acetate kinase

SCOPe Domain Sequences for d4h0pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0pb1 c.55.1.0 (B:5-209) automated matches {Cryptococcus neoformans [TaxId: 5207]}
aeyllaincgsssikgklfaipsfellanlavtnisssdervkikttweegkgkdseeea
dygdkiryaslvpilldhltnsthvkkeeikyvchrvvhggmhdkgirvvkgheeglmem
dklsefaplhnhravlavkscidalphhtslllfdtifhrtiapevytyalpppdteltm
plrkygfhglsyasivqslaehlkk

SCOPe Domain Coordinates for d4h0pb1:

Click to download the PDB-style file with coordinates for d4h0pb1.
(The format of our PDB-style files is described here.)

Timeline for d4h0pb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h0pb2