SCOPe 2.07: Domain d4h0pa2: 4h0p A:210-430

Lineage for d4h0pa2 (4h0p A:210-430)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Cryptococcus neoformans [TaxId:5207] [226536] (1 PDB entry)

8. Domain d4h0pa2: 4h0p A:210-430 [222305]
   Other proteins in same PDB: d4h0pa3, d4h0pb3
   automated match to d1g99a2

Details for d4h0pa2

PDB Entry: 4h0p, 1.89 Å

PDB Description: Crystal Structure of Acetate Kinase from Cryptococcus neoformans

PDB Compounds: (A:) acetate kinase

SCOPe Domain Sequences for d4h0pa2:

Sequence; same for both SEQRES and ATOM records:

>d4h0pa2 c.55.1.0 (A:210-430) automated matches {Cryptococcus neoformans [TaxId: 5207]}
psdqinvvvahlgsgsssccikngksidtsmgltplegllggtrsgtidptaifhhteda
asdanvgdftvskaeiilnknsgfkalagttnfghiiqnldpskcseedhekakltyavf
ldrllnfvaqylfkllsevpiesidglvfsggigekgaelrrdvlkklawlgaevdeean
nsnsggavkcitkegsklkgwvvetdeegwmarmakeefgf

Timeline for d4h0pa2:

• d4h0pa2 first appeared in SCOPe 2.03
  
• d4h0pa2 appears in SCOPe 2.06
  
• d4h0pa2 appears in the current release, SCOPe 2.08