Lineage for d4gwia_ (4gwi A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775422Species Streptococcus mitis [TaxId:28037] [189586] (6 PDB entries)
  8. 2775423Domain d4gwia_: 4gwi A: [222253]
    automated match to d4gwja_
    complexed with ca, gol, mg; mutant

Details for d4gwia_

PDB Entry: 4gwi (more details), 1.6 Å

PDB Description: his 62 mutant of the lectin binding domain of lectinolysin complexed with lewis y
PDB Compounds: (A:) Platelet aggregation factor Sm-hPAF

SCOPe Domain Sequences for d4gwia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gwia_ b.18.1.0 (A:) automated matches {Streptococcus mitis [TaxId: 28037]}
nrpveteniargkqasqsstahggaatravdgnvdsdyghhsvthtnfednawwqvdlgk
tenvgkvklynrgdgnvanrlsnfdvvllneakqevarqhfdslngkaelevfftakdar
yvkvelktkntplslaevevfrsa

SCOPe Domain Coordinates for d4gwia_:

Click to download the PDB-style file with coordinates for d4gwia_.
(The format of our PDB-style files is described here.)

Timeline for d4gwia_: