Lineage for d4gtmb_ (4gtm B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742882Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1743246Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1743374Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 1743375Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 1743390Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 1743400Domain d4gtmb_: 4gtm B: [222157]
    Other proteins in same PDB: d4gtma_
    automated match to d4gtpb_
    complexed with 7tm, dms, fpp, zn

Details for d4gtmb_

PDB Entry: 4gtm (more details), 2.2 Å

PDB Description: FTase in complex with BMS analogue 11
PDB Compounds: (B:) Protein farnesyltransferase subunit beta

SCOPe Domain Sequences for d4gtmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gtmb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekh
fhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdg
gfgggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvgge
vdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaa
lvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaq
gdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgs
gamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

SCOPe Domain Coordinates for d4gtmb_:

Click to download the PDB-style file with coordinates for d4gtmb_.
(The format of our PDB-style files is described here.)

Timeline for d4gtmb_: