SCOPe 2.05: Domain d4gphb_: 4gph B:

Lineage for d4gphb_ (4gph B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
   Uniprot P71119

8. Domain d4gphb_: 4gph B: [222080]
   automated match to d1iw0b_
   complexed with asc, bla, fe, so4

Details for d4gphb_

PDB Entry: 4gph, 1.7 Å

PDB Description: structure of hmuo, heme oxygenase from corynebacterium diphtheriae, in complex with the putative reaction intermediates between fe3+- biliverdin and biliverdin (data set iv)

PDB Compounds: (B:) Heme oxygenase

SCOPe Domain Sequences for d4gphb_:

Sequence; same for both SEQRES and ATOM records:

>d4gphb_ a.132.1.1 (B:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgkgl

Timeline for d4gphb_:

• d4gphb_ first appeared in SCOPe 2.03
  
• d4gphb_ appears in SCOPe 2.04
  
• d4gphb_ appears in SCOPe 2.06
  
• d4gphb_ appears in the current release, SCOPe 2.08