Lineage for d4gnia1 (4gni A:13-196)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858578Species Chaetomium thermophilum [TaxId:759272] [226535] (1 PDB entry)
  8. 1858579Domain d4gnia1: 4gni A:13-196 [222032]
    automated match to d1dkgd1
    complexed with atp, mg

Details for d4gnia1

PDB Entry: 4gni (more details), 1.8 Å

PDB Description: Structure of the Ssz1 ATPase bound to ATP and Magnesium
PDB Compounds: (A:) Putative heat shock protein

SCOPe Domain Sequences for d4gnia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gnia1 c.55.1.0 (A:13-196) automated matches {Chaetomium thermophilum [TaxId: 759272]}
rvvigitfgnsnssiahtvddkaevianedgdrqiptilsyvdgdeyygqqaknflvrnp
kntvayfrdilgqdfksvdpthnhasahpqeagdnvvftikdkaeedaepstltvseiat
rylrrlvgaaseylgkkvtsavitiptnftekqkaaliaaaaaadlevlqlisepaaavl
ayda

SCOPe Domain Coordinates for d4gnia1:

Click to download the PDB-style file with coordinates for d4gnia1.
(The format of our PDB-style files is described here.)

Timeline for d4gnia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gnia2