| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (64 species) not a true protein |
| Species Chaetomium thermophilum [TaxId:759272] [226535] (6 PDB entries) |
| Domain d4gnia1: 4gni A:13-196 [222032] automated match to d1dkgd1 complexed with atp, mg |
PDB Entry: 4gni (more details), 1.8 Å
SCOPe Domain Sequences for d4gnia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gnia1 c.55.1.0 (A:13-196) automated matches {Chaetomium thermophilum [TaxId: 759272]}
rvvigitfgnsnssiahtvddkaevianedgdrqiptilsyvdgdeyygqqaknflvrnp
kntvayfrdilgqdfksvdpthnhasahpqeagdnvvftikdkaeedaepstltvseiat
rylrrlvgaaseylgkkvtsavitiptnftekqkaaliaaaaaadlevlqlisepaaavl
ayda
Timeline for d4gnia1: