Lineage for d1ff5a2 (1ff5 A:102-218)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1110686Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1110687Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1110695Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 1110708Species Mouse (Mus musculus) [TaxId:10090] [49318] (5 PDB entries)
  8. 1110715Domain d1ff5a2: 1ff5 A:102-218 [22203]
    two-domain fragment
    complexed with ca

Details for d1ff5a2

PDB Entry: 1ff5 (more details), 2.93 Å

PDB Description: structure of e-cadherin double domain
PDB Compounds: (A:) epithelial cadherin

SCOPe Domain Sequences for d1ff5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ff5a2 b.1.6.1 (A:102-218) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeftqevfegsvaegavpgtsvmkvsatdadddvntynaaiaytivsqdpelphkn
mftvnrdtgvisvltsgldresyptytlvvqaadlqgeglsttakavitvkdindna

SCOPe Domain Coordinates for d1ff5a2:

Click to download the PDB-style file with coordinates for d1ff5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ff5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ff5a1