SCOPe 2.07: Domain d1edha2: 1edh A:102-213

Lineage for d1edha2 (1edh A:102-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)

8. Domain d1edha2: 1edh A:102-213 [22199]
   two-domain fragment
   complexed with ca, hg

Details for d1edha2

PDB Entry: 1edh, 2 Å

PDB Description: e-cadherin domains 1 and 2 in complex with calcium

PDB Compounds: (A:) e-cadherin

SCOPe Domain Sequences for d1edha2:

Sequence; same for both SEQRES and ATOM records:

>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeftqevfegsvaegavpgtsvmkvsatdadddvntynaaiaytivsqdpelphkn
mftvnrdtgvisvltsgldresyptytlvvqaadlqgeglsttakavitvkd

Timeline for d1edha2:

• d1edha2 first appeared (with stable ids) in SCOP 1.55
  
• d1edha2 appears in SCOPe 2.06
  
• d1edha2 appears in the current release, SCOPe 2.08