SCOPe 2.04: Domain d4ghtb_: 4ght B:

Lineage for d4ghtb_ (4ght B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (19 species)
   not a true protein

7. Species Human enterovirus 71 [TaxId:39054] [189708] (7 PDB entries)

8. Domain d4ghtb_: 4ght B: [221919]
   automated match to d3zv9a_
   complexed with ag7

Details for d4ghtb_

PDB Entry: 4ght, 1.96 Å

PDB Description: Crystal structure of EV71 3C proteinase in complex with AG7088

PDB Compounds: (B:) 3C proteinase

SCOPe Domain Sequences for d4ghtb_:

Sequence; same for both SEQRES and ATOM records:

>d4ghtb_ b.47.1.0 (B:) automated matches {Human enterovirus 71 [TaxId: 39054]}
mgpsldfalsllrrnvrqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnilda
velvdeqgvnleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdv
vqygflnlsgkpthrtmmynfptkagqcggvvtsvgkvigihiggngrqgfcaglkrsyf
a

Timeline for d4ghtb_:

• d4ghtb_ first appeared in SCOPe 2.03
  
• d4ghtb_ appears in SCOPe 2.05
  
• d4ghtb_ appears in the current release, SCOPe 2.08, called d4ghtb1