Lineage for d1ncia_ (1nci A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1298299Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 1298300Family b.1.6.1: Cadherin [49314] (3 proteins)
  6. 1298366Protein N-cadherin (neural) [49315] (1 species)
  7. 1298367Species Mouse (Mus musculus) [TaxId:10090] [49316] (6 PDB entries)
  8. 1298368Domain d1ncia_: 1nci A: [22191]
    domain 1
    complexed with ium

Details for d1ncia_

PDB Entry: 1nci (more details), 2.1 Å

PDB Description: structural basis of cell-cell adhesion by cadherins
PDB Compounds: (A:) n-cadherin

SCOPe Domain Sequences for d1ncia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]}
gsdwvippinlpensrgpfpqelvrirsgrdknlslrysvtgpgadqpptgifiinpisg
qlsvtkpldreliarfhlrahavdingnqvenpidivinvid

SCOPe Domain Coordinates for d1ncia_:

Click to download the PDB-style file with coordinates for d1ncia_.
(The format of our PDB-style files is described here.)

Timeline for d1ncia_: