Lineage for d1ncia_ (1nci A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.6: Cadherin [49313] (1 family) 
Family b.1.6.1: Cadherin [49314] (2 proteins) Protein N-cadherin (neural) [49315] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [49316] (4 PDB entries) 
Domain d1ncia_: 1nci A: [22191]
Details for d1ncia_
PDB Entry: 1nci (more details), 1.9 Å
PDB Description: structural basis of cell-cell adhesion by cadherins
SCOP Domain Sequences for d1ncia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus)}
gsdwvippinlpensrgpfpqelvrirsgrdknlslrysvtgpgadqpptgifiinpisg
qlsvtkpldreliarfhlrahavdingnqvenpidivinvid
SCOP Domain Coordinates for d1ncia_:
Click to download the PDB-style file with coordinates for d1ncia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ncia_:
- d1ncia_ appears in SCOP 1.57
- d1ncia_ appears in the current release, SCOPe 2.08
View in 3D
