Lineage for d4ghga1 (4ghg A:3-147)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1645158Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1645159Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1645312Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 1645401Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species)
  7. 1645415Species Brevibacterium fuscum [TaxId:47914] [89888] (14 PDB entries)
  8. 1645416Domain d4ghga1: 4ghg A:3-147 [221899]
    automated match to d1q0oa1
    complexed with ca, cl, dhy, fe2, p6g, pg4

Details for d4ghga1

PDB Entry: 4ghg (more details), 1.5 Å

PDB Description: Structure of Homoprotocatechuate 2,3-Dioxygenase from B.fuscum in complex with HPCA at 1.50 Ang resolution
PDB Compounds: (A:) homoprotocatechuate 2,3-dioxygenase

SCOPe Domain Sequences for d4ghga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ghga1 d.32.1.3 (A:3-147) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]}
neipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihh
nlvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedpl
gfpyefffetthverlhmrydlysa

SCOPe Domain Coordinates for d4ghga1:

Click to download the PDB-style file with coordinates for d4ghga1.
(The format of our PDB-style files is described here.)

Timeline for d4ghga1: