Lineage for d4gera_ (4ger A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423492Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1423493Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1423507Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 1423644Protein automated matches [191194] (2 species)
    not a true protein
  7. 1423645Species Paenibacillus polymyxa [TaxId:1406] [193740] (2 PDB entries)
  8. 1423646Domain d4gera_: 4ger A: [221876]
    automated match to d4b52b_
    complexed with ca, lys, thr, zn

Details for d4gera_

PDB Entry: 4ger (more details), 1.59 Å

PDB Description: Crystal structure of Gentlyase, the neutral metalloprotease of Paenibacillus polymyxa
PDB Compounds: (A:) Gentlyase metalloprotease

SCOPe Domain Sequences for d4gera_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gera_ d.92.1.2 (A:) automated matches {Paenibacillus polymyxa [TaxId: 1406]}
atgtgkgvlgdtksftttasgssyqlkdttrgngvvtytasnrqsipgtiltdadnvwnd
pagvdahtyaaktydyykakfgrnsidgrglqlrstvhygsrynnafwngsqmtygdgdg
stfiafsgdpdvvghelthgvteytsnleyygesgalneafsdvigndiqrknwlvgddi
ytpniagdalrsmsnptlydqpdhysnlytgssdnggvhtnsgiinkayyllaqggtfhg
vtvngigrdaavqiyysaftnyltsssdfsnaraaviqaakdqygansaeataaaksfda
vgvn

SCOPe Domain Coordinates for d4gera_:

Click to download the PDB-style file with coordinates for d4gera_.
(The format of our PDB-style files is described here.)

Timeline for d4gera_: