SCOPe 2.07: Domain d4ge3c_: 4ge3 C:

Lineage for d4ge3c_ (4ge3 C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (24 species)
   not a true protein

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [226442] (4 PDB entries)

8. Domain d4ge3c_: 4ge3 C: [221865]
   automated match to d2ab0a1
   complexed with edo, mg; mutant

Details for d4ge3c_

PDB Entry: 4ge3, 1.5 Å

PDB Description: schizosaccharomyces pombe dj-1 t114v mutant

PDB Compounds: (C:) Uncharacterized protein C22E12.03c

SCOPe Domain Sequences for d4ge3c_:

Sequence; same for both SEQRES and ATOM records:

>d4ge3c_ c.23.16.0 (C:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
mvkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrsyke
ipsaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagvltakts
glpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvaskdk
ynavykslsmp

Timeline for d4ge3c_:

• d4ge3c_ first appeared in SCOPe 2.03
  
• d4ge3c_ appears in SCOPe 2.06
  
• d4ge3c_ appears in the current release, SCOPe 2.08