Lineage for d4ge3c_ (4ge3 C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467511Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2467512Protein automated matches [190197] (24 species)
    not a true protein
  7. 2467661Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [226442] (4 PDB entries)
  8. 2467676Domain d4ge3c_: 4ge3 C: [221865]
    automated match to d2ab0a1
    complexed with edo, mg; mutant

Details for d4ge3c_

PDB Entry: 4ge3 (more details), 1.5 Å

PDB Description: schizosaccharomyces pombe dj-1 t114v mutant
PDB Compounds: (C:) Uncharacterized protein C22E12.03c

SCOPe Domain Sequences for d4ge3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ge3c_ c.23.16.0 (C:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
mvkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrsyke
ipsaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagvltakts
glpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvaskdk
ynavykslsmp

SCOPe Domain Coordinates for d4ge3c_:

Click to download the PDB-style file with coordinates for d4ge3c_.
(The format of our PDB-style files is described here.)

Timeline for d4ge3c_: