Lineage for d4ge3b_ (4ge3 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1589127Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1589536Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 1589537Protein automated matches [190197] (15 species)
    not a true protein
  7. 1589656Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [226442] (4 PDB entries)
  8. 1589670Domain d4ge3b_: 4ge3 B: [221864]
    automated match to d2ab0a1
    complexed with edo, mg; mutant

Details for d4ge3b_

PDB Entry: 4ge3 (more details), 1.5 Å

PDB Description: schizosaccharomyces pombe dj-1 t114v mutant
PDB Compounds: (B:) Uncharacterized protein C22E12.03c

SCOPe Domain Sequences for d4ge3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ge3b_ c.23.16.0 (B:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
mvkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrsyke
ipsaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagvltakts
glpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvaskdk
ynavykslsmp

SCOPe Domain Coordinates for d4ge3b_:

Click to download the PDB-style file with coordinates for d4ge3b_.
(The format of our PDB-style files is described here.)

Timeline for d4ge3b_: