Lineage for d1ggub2 (1ggu B:516-627)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105675Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) (S)
  5. 105676Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 105677Protein Transglutaminase, two C-terminal domains [49311] (2 species)
  7. 105678Species Human (Homo sapiens) [TaxId:9606] [49312] (7 PDB entries)
  8. 105689Domain d1ggub2: 1ggu B:516-627 [22181]
    Other proteins in same PDB: d1ggua1, d1ggua4, d1ggub1, d1ggub4

Details for d1ggub2

PDB Entry: 1ggu (more details), 2.1 Å

PDB Description: human factor xiii with calcium bound in the ion site

SCOP Domain Sequences for d1ggub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggub2 b.1.5.1 (B:516-627) Transglutaminase, two C-terminal domains {Human (Homo sapiens)}
snvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfdv
tleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl

SCOP Domain Coordinates for d1ggub2:

Click to download the PDB-style file with coordinates for d1ggub2.
(The format of our PDB-style files is described here.)

Timeline for d1ggub2: