SCOPe 2.05: Domain d4g9ab_: 4g9a B:

Lineage for d4g9ab_ (4g9a B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143958] (12 PDB entries)
   Uniprot P06734 156-298

8. Domain d4g9ab_: 4g9a B: [221808]
   automated match to d1t8ca1
   complexed with ca, gol

Details for d4g9ab_

PDB Entry: 4g9a, 2 Å

PDB Description: Crystal structure of calcium2+-bound wild-type CD23 lectin domain

PDB Compounds: (B:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4g9ab_:

Sequence; same for both SEQRES and ATOM records:

>d4g9ab_ d.169.1.1 (B:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
gfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhash
tgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdrk
lgawvcdrlatctpp

Timeline for d4g9ab_:

• d4g9ab_ first appeared in SCOPe 2.03
  
• d4g9ab_ appears in SCOPe 2.04
  
• d4g9ab_ appears in SCOPe 2.06
  
• d4g9ab_ appears in the current release, SCOPe 2.08