Lineage for d4g96b_ (4g96 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2234736Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species)
  7. 2234737Species Human (Homo sapiens) [TaxId:9606] [143958] (12 PDB entries)
    Uniprot P06734 156-298
  8. 2234751Domain d4g96b_: 4g96 B: [221802]
    automated match to d1t8ca1
    complexed with edo, so4

Details for d4g96b_

PDB Entry: 4g96 (more details), 2.25 Å

PDB Description: Crystal structure of calcium2+-free wild-type CD23 lectin domain
PDB Compounds: (B:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4g96b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g96b_ d.169.1.1 (B:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
gfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhash
tgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdrk
lgawvcdrlatctpp

SCOPe Domain Coordinates for d4g96b_:

Click to download the PDB-style file with coordinates for d4g96b_.
(The format of our PDB-style files is described here.)

Timeline for d4g96b_: