Lineage for d4g7qb1 (4g7q B:3-40)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024004Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 3024005Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 3024027Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)
  7. 3024028Species Thermus thermophilus [TaxId:274] [81459] (23 PDB entries)
    the "missing" first helix is complemented by the ba3 subunit IIa
  8. 3024043Domain d4g7qb1: 4g7q B:3-40 [221750]
    Other proteins in same PDB: d4g7qa_, d4g7qb2, d4g7qc_
    automated match to d1ehkb2
    complexed with cu, cua, has, hem, olc, per; mutant

    fragment; missing more than one-third of the common structure and/or sequence

Details for d4g7qb1

PDB Entry: 4g7q (more details), 2.6 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant V236L from Thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d4g7qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7qb1 f.17.2.1 (B:3-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dehkahkailayekgwlafslamlfvfialiaytlath

SCOPe Domain Coordinates for d4g7qb1:

Click to download the PDB-style file with coordinates for d4g7qb1.
(The format of our PDB-style files is described here.)

Timeline for d4g7qb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g7qb2