Lineage for d1bhgb1 (1bhg B:226-328)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 54910Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 54911Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 55002Protein beta-Glucuronidase [49307] (1 species)
  7. 55003Species Human (Homo sapiens) [TaxId:9606] [49308] (1 PDB entry)
  8. 55005Domain d1bhgb1: 1bhg B:226-328 [22162]
    Other proteins in same PDB: d1bhga2, d1bhga3, d1bhgb2, d1bhgb3

Details for d1bhgb1

PDB Entry: 1bhg (more details), 2.6 Å

PDB Description: human beta-glucuronidase at 2.6 a resolution

SCOP Domain Sequences for d1bhgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhgb1 b.1.4.1 (B:226-328) beta-Glucuronidase {Human (Homo sapiens)}
tyidditvttsveqdsglvnyqisvkgsnlfklevrlldaenkvvangtgtqgqlkvpgv
slwwpylmherpaylyslevqltaqtslgpvsdfytlpvgirt

SCOP Domain Coordinates for d1bhgb1:

Click to download the PDB-style file with coordinates for d1bhgb1.
(The format of our PDB-style files is described here.)

Timeline for d1bhgb1: