Lineage for d1bhgb2 (1bhg B:22-225)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57188Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 57189Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families) (S)
  5. 57225Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 57272Protein beta-Glucuronidase [49806] (1 species)
  7. 57273Species Human (Homo sapiens) [TaxId:9606] [49807] (1 PDB entry)
  8. 57275Domain d1bhgb2: 1bhg B:22-225 [23767]
    Other proteins in same PDB: d1bhga1, d1bhga3, d1bhgb1, d1bhgb3

Details for d1bhgb2

PDB Entry: 1bhg (more details), 2.6 Å

PDB Description: human beta-glucuronidase at 2.6 a resolution

SCOP Domain Sequences for d1bhgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhgb2 b.18.1.5 (B:22-225) beta-Glucuronidase {Human (Homo sapiens)}
glqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvps
sfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtle
heggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyfv
qntyfdffnyaglqrsvllyttpt

SCOP Domain Coordinates for d1bhgb2:

Click to download the PDB-style file with coordinates for d1bhgb2.
(The format of our PDB-style files is described here.)

Timeline for d1bhgb2: