SCOPe 2.08: Domain d4fx3d1: 4fx3 D:175-309

Lineage for d4fx3d1 (4fx3 D:175-309)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d4fx3d1: 4fx3 D:175-309 [221589]
   Other proteins in same PDB: d4fx3a_, d4fx3c_
   automated match to d1h1pb1
   complexed with 60k, dtt

Details for d4fx3d1

PDB Entry: 4fx3, 2.75 Å

PDB Description: crystal structure of the cdk2/cyclin a complex with oxindole inhibitor

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4fx3d1:

Sequence; same for both SEQRES and ATOM records:

>d4fx3d1 a.74.1.1 (D:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

Timeline for d4fx3d1:

• d4fx3d1 first appeared in SCOPe 2.03
  
• d4fx3d1 appears in SCOPe 2.07