Lineage for d4fwpa2 (4fwp A:193-397)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372826Family c.55.1.2: Acetokinase-like [53080] (3 proteins)
  6. 1372861Protein Propionate kinase [142462] (1 species)
  7. 1372862Species Salmonella typhimurium [TaxId:90371] [142463] (10 PDB entries)
    Uniprot O06961 193-397! Uniprot O06961 4-192
  8. 1372876Domain d4fwpa2: 4fwp A:193-397 [221580]
    automated match to d1x3ma1
    complexed with edo, gdp

Details for d4fwpa2

PDB Entry: 4fwp (more details), 2.5 Å

PDB Description: crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gdp
PDB Compounds: (A:) Propionate kinase

SCOPe Domain Sequences for d4fwpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fwpa2 c.55.1.2 (A:193-397) Propionate kinase {Salmonella typhimurium [TaxId: 90371]}
dekdsglivahlgngasicavrngqsvdtsmgmtpleglmmgtrsgdvdfgamawiaket
gqtlsdlervvnkesgllgisglssdlrvlekawhegherarlaiktfvhriarhiagha
aslhrldgiiftggigensvlirqlviehlgvlgltldvemnkqpnshgeriisanpsqv
icaviptneekmialdaihlgnvka

SCOPe Domain Coordinates for d4fwpa2:

Click to download the PDB-style file with coordinates for d4fwpa2.
(The format of our PDB-style files is described here.)

Timeline for d4fwpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fwpa1