| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.2: Acetokinase-like [53080] (3 proteins) |
| Protein Propionate kinase [142462] (1 species) |
| Species Salmonella typhimurium [TaxId:90371] [142463] (12 PDB entries) Uniprot O06961 193-397! Uniprot O06961 4-192 |
| Domain d4fwpa2: 4fwp A:193-397 [221580] automated match to d1x3ma1 complexed with edo, gdp |
PDB Entry: 4fwp (more details), 2.5 Å
SCOPe Domain Sequences for d4fwpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fwpa2 c.55.1.2 (A:193-397) Propionate kinase {Salmonella typhimurium [TaxId: 90371]}
dekdsglivahlgngasicavrngqsvdtsmgmtpleglmmgtrsgdvdfgamawiaket
gqtlsdlervvnkesgllgisglssdlrvlekawhegherarlaiktfvhriarhiagha
aslhrldgiiftggigensvlirqlviehlgvlgltldvemnkqpnshgeriisanpsqv
icaviptneekmialdaihlgnvka
Timeline for d4fwpa2: