Lineage for d4fufa_ (4fuf A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1547005Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 1547006Species Human (Homo sapiens) [TaxId:9606] [50587] (68 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 1547028Domain d4fufa_: 4fuf A: [221530]
    automated match to d4fuba_
    complexed with 8up, act, gol, sin, so4

Details for d4fufa_

PDB Entry: 4fuf (more details), 2 Å

PDB Description: crystal structure of the urokinase
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d4fufa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fufa_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtk

SCOPe Domain Coordinates for d4fufa_:

Click to download the PDB-style file with coordinates for d4fufa_.
(The format of our PDB-style files is described here.)

Timeline for d4fufa_: