| Class b: All beta proteins [48724] (176 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
| Protein automated matches [190077] (17 species) not a true protein |
| Species Horse (Equus caballus) [TaxId:9796] [226528] (2 PDB entries) |
| Domain d4frva_: 4frv A: [221485] automated match to d3icia_ complexed with me2, peg, zn |
PDB Entry: 4frv (more details), 1.1 Å
SCOPe Domain Sequences for d4frva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4frva_ b.62.1.1 (A:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
amdekkkrpkvtvkvyfdlrigdedigrvviglfgktvpktvdnfvalatgekgfgykds
kfhrvikdfmiqggdftrgdgtggksiygerfpdenfklkhygpgwvsmanagkdtngsq
ffittvktawldgkhvvfgkvlegmevvrkvettktdgrdkplkdvtiadcgkievekpf
aiake
Timeline for d4frva_: