SCOPe 2.04: Domain d4frva_: 4frv A:

Lineage for d4frva_ (4frv A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (17 species)
   not a true protein

7. Species Horse (Equus caballus) [TaxId:9796] [226528] (2 PDB entries)

8. Domain d4frva_: 4frv A: [221485]
   automated match to d3icia_
   complexed with me2, peg, zn

Details for d4frva_

PDB Entry: 4frv, 1.1 Å

PDB Description: crystal structure of mutated cyclophilin b that causes hyperelastosis cutis in the american quarter horse

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d4frva_:

Sequence; same for both SEQRES and ATOM records:

>d4frva_ b.62.1.1 (A:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
amdekkkrpkvtvkvyfdlrigdedigrvviglfgktvpktvdnfvalatgekgfgykds
kfhrvikdfmiqggdftrgdgtggksiygerfpdenfklkhygpgwvsmanagkdtngsq
ffittvktawldgkhvvfgkvlegmevvrkvettktdgrdkplkdvtiadcgkievekpf
aiake

Timeline for d4frva_:

• d4frva_ first appeared in SCOPe 2.03
  
• d4frva_ appears in SCOPe 2.05
  
• d4frva_ appears in the current release, SCOPe 2.08, called d4frva1