Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein automated matches [190469] (12 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [189990] (2 PDB entries) |
Domain d4foad_: 4foa D: [221391] automated match to d3qj7c_ complexed with ufp |
PDB Entry: 4foa (more details), 2.25 Å
SCOPe Domain Sequences for d4foad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4foad_ d.117.1.1 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mtpyedllrfvletgtpksdrtgtgtrslfgqqmrydlsagfpllttkkvhfksvayell wflrgdsnigwlhehgvtiwdewasdtgelgpiygvqwrswpapsgehidqisaaldllr tdpdsrriivsawnvgeiermalppchaffqfyvadgrlscqlyqrsadlflgvpfnias yallthmmaaqaglsvgefiwtggdchiydnhveqvrlqlsreprpypkllladrdsife ytyedivvknydphpaikapv
Timeline for d4foad_: