| Class b: All beta proteins [48724] (180 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
| Protein automated matches [226835] (41 species) not a true protein |
| Species Neisseria polysaccharea [TaxId:489] [226281] (7 PDB entries) |
| Domain d4floa2: 4flo A:555-628 [221268] Other proteins in same PDB: d4floa1, d4floa3 automated match to d1g5aa1 complexed with gol, p6g, trs; mutant |
PDB Entry: 4flo (more details), 2.2 Å
SCOPe Domain Sequences for d4floa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4floa2 b.71.1.0 (A:555-628) automated matches {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia
Timeline for d4floa2: