Lineage for d4fk8a2 (4fk8 A:116-271)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467994Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467995Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2468165Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2468166Protein automated matches [226871] (19 species)
    not a true protein
  7. 2468177Species Burkholderia thailandensis [TaxId:271848] [226397] (2 PDB entries)
  8. 2468178Domain d4fk8a2: 4fk8 A:116-271 [221245]
    Other proteins in same PDB: d4fk8a1, d4fk8b1
    automated match to d1a8pa2
    complexed with fad

Details for d4fk8a2

PDB Entry: 4fk8 (more details), 2.1 Å

PDB Description: crystal structure of ferredoxin-nadp reductase from burkholderia thailandensis e264 with bound fad
PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d4fk8a2:

Sequence, based on SEQRES records: (download)

>d4fk8a2 c.25.1.0 (A:116-271) automated matches {Burkholderia thailandensis [TaxId: 271848]}
adnllpgktlwmlstgtglapfmsiirdpdiyerfdkvvlthtcrlkgelaymdyikhdl
pgheylgdvireklvyyptvtreefenegritdliasgklftdldmppfspeqdrvmlcg
stamlkdttellkkaglvegknsapghyvierafvd

Sequence, based on observed residues (ATOM records): (download)

>d4fk8a2 c.25.1.0 (A:116-271) automated matches {Burkholderia thailandensis [TaxId: 271848]}
adnllpgktlwmlstgtglapfmsiirdpdiyerfdkvvlthtcrlkgelaymdyikhdl
pgheylgdvireklvyyptvegritdliasgklftdldmppfspeqdrvmlcgstamlkd
ttellkkaglvegknsapghyvierafvd

SCOPe Domain Coordinates for d4fk8a2:

Click to download the PDB-style file with coordinates for d4fk8a2.
(The format of our PDB-style files is described here.)

Timeline for d4fk8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fk8a1